PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00038.1.g03420.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 430aa    MW: 45466.8 Da    PI: 10.7072
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00038.1.g03420.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof110.58.3e-35242296660
                        zf-Dof   6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                                    +cprC s++tkfCyynny+++qPr+fC+aCrryWt GG+lrnvPvGg++rk+ +
  Zjn_sc00038.1.g03420.1.am.mk 242 EQCPRCASRDTKFCYYNNYNTAQPRHFCRACRRYWTLGGSLRNVPVGGSTRKRPR 296
                                   68*************************************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088427.615242296IPR003851Zinc finger, Dof-type
PfamPF027013.8E-30242294IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-21243289IPR003851Zinc finger, Dof-type
PROSITE patternPS013610244280IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 430 aa     Download sequence    Send to blast
MHARRIAFEL LQQSTSGLSG LSLKATKELA AGRALHAERI SPAGRPASVR PRRRMEILSL  60
SGGAPATRYA PIPAAERGSF DPSRIVFGVT TRRSRQLFVS STYTRKQRNV PSTSSDWSRP  120
CLSLLSPALY LPPPYESTGC RADEQSLSRE RDKHSIANPK SELLTQEPTT SAMEAPLYHL  180
PVPIPAPGVP ALPATLRQND ATIGAVIHQQ QQQAAAVSAV ITAQKKPPPP PPPPTVMATG  240
REQCPRCASR DTKFCYYNNY NTAQPRHFCR ACRRYWTLGG SLRNVPVGGS TRKRPRPARP  300
TRALAAAVAT MSSSGTTTTT TTAAAPSCSG PGIFGGSPVP APAQNGSLLS SLLVGSTGAS  360
DLFAYPAFSA GQLLWPATVL DGDRPETTSK AGGAFPLPFP PADALWQELA AAMPSAAGAG  420
APQPQPQLLL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1292296KRPRP
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY6616592e-63AY661659.1 Sorghum bicolor clone BAC 75D9, complete sequence.
GenBankHQ5400842e-63HQ540084.1 Sorghum bicolor clone SbDof1 Dof-type zinc finger protein gene, complete cds.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.19e-24DOF zinc finger protein 1